3/17/2024 0 Comments Filemass listingKQGTLDRKYAGILDCFKRTATQEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGįKKEEGYAKWFAGNLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIĭVYKKTLKSDGVAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGSLEGSFLASFL MSSNAQVKTPLPPAPAPKKESNFLIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEML >YBL030C PET9 SGDID:S000000126, Chr II from 164000-163044, reverse complement, Verified ORF, "Major ADP/ATP carrier of the mitochondrial inner membrane, exchanges cytosolic ADP for mitochondrially synthesized ATP required for viability in many common lab strains carrying a mutation in the polymorphic SAL1 gene" The beginning of the file looks like this. A sample fasta file is also comes with the distribution inĭoc/example-files. This file is in fasta format and containsĪ list of proteins you expect to find in your sample and their The second input file you will need is a protein database. Input file: protein database (fasta file) Repeat this pattern of S line, Z line(s), and peak list. Spectrum (in this case 2) and the mass of the peptide at thatĬharge state. (twice) and the m/z of the precursor ion. The file, the date it was created, and so on. Header lines and contain information about the program that generated Information specific to the above charge state. Lines beginning with I are contain information independent of the NOTE: There are two kinds of optional lines which
0 Comments
Leave a Reply. |
AuthorWrite something about yourself. No need to be fancy, just an overview. ArchivesCategories |